PDB entry 3bc1

View 3bc1 on RCSB PDB site
Description: Crystal Structure of the complex Rab27a-Slp2a
Class: signaling protein/transport protein
Keywords: Rab27, GTPase, Rab, signaling protein, GDPNP, Slp2a, Exophilin-4, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, SIGNALING PROTEIN-TRANSPORT PROTEIN COMPLEX
Deposited on 2007-11-12, released 2008-09-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-27A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ERI2
      • engineered (79)
      • engineered (124)
      • engineered (189)
    Domains in SCOPe 2.01: d3bc1a_
  • Chain 'B':
    Compound: Synaptotagmin-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCH5 (5-End)
      • expression tag (0-4)
  • Chain 'E':
    Compound: Ras-related protein Rab-27A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ERI2
      • engineered (79)
      • engineered (124)
    Domains in SCOPe 2.01: d3bc1e_
  • Chain 'F':
    Compound: Synaptotagmin-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCH5 (5-End)
      • expression tag (0-4)
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bc1A (A:)
    gsmsdgdydylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrekrvvyrangp
    dgavgrgqrihlqlwdtaglerfrslttaffrdamgflllfdltneqsflnvrnwisqlq
    mhaysenpdivlcgnksdledqravkeeearelaekygipyfetsaangtnishaiemll
    dlimkrmersvdksw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bc1A (A:)
    gdydylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrekrvvyrangpdgavg
    rgqrihlqlwdtaglerfrslttaffrdamgflllfdltneqsflnvrnwisqlqmhays
    enpdivlcgnksdledqravkeeearelaekygipyfetsaangtnishaiemlldlimk
    rmers
    

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bc1E (E:)
    gsmsdgdydylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrekrvvyrangp
    dgavgrgqrihlqlwdtaglerfrslttaffrdamgflllfdltneqsflnvrnwisqlq
    mhaysenpdivlcgnksdledqravkeeearelaekygipyfetsaangtnishaiemll
    dlimkrmersvdksw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bc1E (E:)
    gdydylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrekrvvyragqrihlql
    wdtaglerfrslttaffrdamgflllfdltneqsflnvrnwisqlqmhaysenpdivlcg
    nksdledqravkeeearelaekygipyfetsaangtnishaiemlldlimkrmer
    

  • Chain 'F':
    No sequence available.