PDB entry 3bbt

View 3bbt on RCSB PDB site
Description: crystal structure of the ErbB4 kinase in complex with lapatinib
Class: transferase
Keywords: inactive kinase conformation, ATP-binding, Glycoprotein, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2007-11-11, released 2008-02-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.253
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3bbtb_
  • Chain 'D':
    Compound: Receptor tyrosine-protein kinase erbB-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB4, HER4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3bbtd_
  • Heterogens: FMM, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bbtB (B:)
    gtapnqaqlrilketelkrvkvlgsgafgtvykgiwvpegetvkipvaikilnettgpka
    nvefmdealimasmdhphlvrllgvclsptiqlvtqlmphgclleyvhehkdnigsqlll
    nwcvqiakgmmyleerrlvhrdlaarnvlvkspnhvkitdfglarllegdekeynadggk
    mpikwmalecihyrkfthqsdvwsygvtiwelmtfggkpydgiptreipdllekgerlpq
    ppictidvymvmvkcwmidadsrpkfkelaaefsrmardpqrylviqgddrmklpspnds
    kffqnlldeedledmmdaeeylvpqafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbtB (B:)
    aqlrilketelkrvkvlgsgafgtvykgiwvpegetvkipvaikilnegpkanvefmdea
    limasmdhphlvrllgvclsptiqlvtqlmphgclleyvhehkdnigsqlllnwcvqiak
    gmmyleerrlvhrdlaarnvlvkspnhvkitdfglarllpikwmalecihyrkfthqsdv
    wsygvtiwelmtfggkpydgiptreipdllekgerlpqppictidvymvmvkcwmidads
    rpkfkelaaefsrmardpqrylviqddrmklpsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bbtD (D:)
    gtapnqaqlrilketelkrvkvlgsgafgtvykgiwvpegetvkipvaikilnettgpka
    nvefmdealimasmdhphlvrllgvclsptiqlvtqlmphgclleyvhehkdnigsqlll
    nwcvqiakgmmyleerrlvhrdlaarnvlvkspnhvkitdfglarllegdekeynadggk
    mpikwmalecihyrkfthqsdvwsygvtiwelmtfggkpydgiptreipdllekgerlpq
    ppictidvymvmvkcwmidadsrpkfkelaaefsrmardpqrylviqgddrmklpspnds
    kffqnlldeedledmmdaeeylvpqafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbtD (D:)
    qlrilketelkrvkvlgsgafgtvykgiwvpetvkipvaikilnepkanvefmdealima
    smdhphlvrllgvclsptiqlvtqlmphgclleyvhehkdnigsqlllnwcvqiakgmmy
    leerrlvhrdlaarnvlvkspnhvkitdfglarpikwmalecihyrkfthqsdvwsygvt
    iwelmtfggkpydgiptreipdllekgerlpqppictidvymvmvkcwmidadsrpkfke
    laaefsrmardpqrylviq