PDB entry 3bbo

View 3bbo on RCSB PDB site
Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome
Class: ribosome
Keywords: large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex, ribosome
Deposited on 2007-11-09, released 2008-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: EM
Resolution: 9.4 Å
R-factor: N/A
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: ribosomal protein L31
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO
  • Chain '2':
    Compound: ribosomal protein l32
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: ribosomal protein L33
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: ribosomal protein L34
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: ribosomal protein L35
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: ribosomal protein L36
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO (0-End)
    Domains in SCOPe 2.04: d3bbo61
  • Chain 'A':
    Compound: 23s rRNA
    Species: Spinacea oleracea [TaxId:3562]
  • Chain 'B':
    Compound: 5s rRNA
    Species: Spinacea oleracea [TaxId:3562]
  • Chain 'C':
    Compound: 4.8S rRNA
    Species: Spinacea oleracea [TaxId:3562]
  • Chain 'D':
    Compound: ribosomal protein l1
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ribosomal protein l2
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ribosomal protein l3
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO
  • Chain 'G':
    Compound: ribosomal protein l4
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ribosomal protein l5
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bboh1
  • Chain 'I':
    Compound: ribosomal protein l6
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO (Start-222)
  • Chain 'J':
    Compound: ribosomal protein l9
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO (Start-196)
    Domains in SCOPe 2.04: d3bboj1
  • Chain 'K':
    Compound: ribosomal protein l11
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bbok1
  • Chain 'L':
    Compound: ribosomal protein l13
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bbol1
  • Chain 'M':
    Compound: ribosomal protein l14
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: ribosomal protein l15
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO
  • Chain 'O':
    Compound: ribosomal protein L16
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bboo1
  • Chain 'P':
    Compound: ribosomal protein L17
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO (Start-204)
    Domains in SCOPe 2.04: d3bbop1
  • Chain 'Q':
    Compound: ribosomal protein l18
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO (Start-160)
  • Chain 'R':
    Compound: ribosomal protein l19
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: ribosomal protein L20
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: ribosomal protein L21
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: ribosomal protein l22
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09594
      • conflict (125)
    Domains in SCOPe 2.04: d3bbou1
  • Chain 'V':
    Compound: ribosomal protein l23
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bbov1
  • Chain 'W':
    Compound: ribosomal protein l24
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: ribosomal protein L27
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO
    Domains in SCOPe 2.04: d3bbox1
  • Chain 'Y':
    Compound: Ribosomal Protein L28
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO (Start-150)
  • Chain 'Z':
    Compound: ribosomal protein l29
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBO

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >3bbo6 (6:)
    mkvrssvkkmcefcktvkrrgrvyvicssnpkhkqrqggfssfayegitpsplfaepias
    qelvrlpgqgvsaglasllhkrpmptayfgwrsglasilfkqgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbo6 (6:)
    mkvrssvkkmcefcktvkrrgrvyvicssnpkhkqrqg
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bboH (H:)
    aagtavfvdkaeaetinrlktnyiekmvpllkeefsysnilevpkvvkivvncgigdasq
    nakgldaainelalitgqrpvktkaktsiagfkvregmtlgiavtlrgnlmysfldrlin
    lalprtrdfqgvnpnsfdghgnysvgfreqsvfpeikpeivgkargmdvcitttaktdke
    aykllslmgmpfregsgpstlvrkkklkshhfdakkgrry
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboH (H:)
    rlktnyiekmvpllkeefsysnilevpkvvkivvncgigdasqnakgldaainelalitg
    qrpvktkaktsiagfkvregmtlgiavtlrgnlmysfldrlinlalprtrdfqgvnpnsf
    dghgnysvgfreqsvfpeikpeivgkargmdvcitttaktdkeaykllslmgmpf
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3bboJ (J:)
    masstalslswssspcwshsfngganetlkvserrfnfevvsqkkakklrkvilkedvtd
    lgkqgqlldvkagffrnfllptgkaqlmtplllkelkmederieaekqrvkeeaqqlamv
    fqtvgafkvkrkggkgklifgsvtaqdlvdiiksqlqkdidkrlvslpeiretgeyiael
    klhpdvtarvkinvfan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboJ (J:)
    rkvilkedvtdlgkqgqlldvkagffrnfllptgkaqlmtplllkelkmederieaekqr
    vkeeaqqlamvfqtvgafkvkrkggkgklifgsvtaqdlvdiiksqlqkdidkrlvslpe
    iretgeyiaelklhpdvtarvkinvfan
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3bboK (K:)
    maqplvaapssssitspiprklcsslltpsslslssnprnslqflnsklflsppstshrr
    lsivamapkpgkakkvigviklaleagkatpappvgpalgskgvnimafckdynartadk
    pgfvipveitvfddksftfilktppasvlllkasgaekgskdpqmekvgkitidqlrgia
    teklpdlncttiesamriiagtaanmgididppilvkkkkevif
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboK (K:)
    apkpgkakkvigviklaleagkatpappvgpalgskgvnimafckdynartadkpgfvip
    veitvfddksftfilktppasvlllkasgaekgskdpqmekvgkitidqlrgiateklpd
    lncttiesamriiagtaanmgidid
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3bboL (L:)
    matmacassltfpsaqtqksffgtnvkqtpvlsfprptvaaavavsarkstsastkctee
    wrqlkeavkkefaiphvpldqrwmftleeatgpdiwnttwypksadhvptdkkwyvvdat
    dlilgrmastiaihirgknlasytpsvdmgafvivvnadkvavsgkkrtqklyrrhsgrp
    gglkeetfdqlqkriperiiehavrgmlpkgrlgrylfnhlkvykgaehphqaqqpidlp
    lrdkrirvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboL (L:)
    kkwyvvdatdlilgrmastiaihirgknlasytpsvdmgafvivvnadkvavsgkkrtqk
    lyrrhsgrpgglkeetfdqlqkriperiiehavrgmlpkgrlgrylfnhlkvykgaehph
    qaqqp
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bboO (O:)
    mlspkrtrfrkqhrgrmkgisyrgnricfgryalqalepawitsrqieagrramtrnarr
    ggkiwvrifpdkpvtvrpaetrmgsgkgspeywvavvkpgrilyeisgvaeniarravai
    aaskmpirtqfiisg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3bboP (P:)
    masasttwsmsclksalpsiqpisssslrfscgpspsrlrickpksssrllhsfvglapl
    hpllslssqdstsfehsftvidnggrvfamrhgrkvpklnrppdqrrallrglttqllkh
    grikttkararavrkyvdkmitmakdgslhkrrqalgfiyekqivhalfaevpdrygern
    ggytriirtlprrgdnapmayielv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboP (P:)
    mrhgrkvpklnrppdqrrallrglttqllkhgrikttkararavrkyvdkmitmakdgsl
    hkrrqalgfiyekqivhalfaevpdrygernggytriirtlprrgdnapmayielv
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3bboU (U:)
    mgffkkkekkaefdvfrlyglhhpepgkcdeittrgysismsvdkarrvidqirgrsyae
    tlmilelmpyracypifkliysaaanashnkqfnkanliiskaevnkgitlkkvkprarg
    rsymilrptchitivlrdithfdsydkflesltpkkliallglmstgrrrellcgrfren
    hkiksflykialfkryevm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboU (U:)
    deittrgysismsvdkarrvidqirgrsyaetlmilelmpyracypifkliysaaanash
    nkqfnkanliiskaevnkgitlkkvkprargrsymilrptchitivlrdithfdsydkfl
    es
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3bboV (V:)
    mattapnlhslsssfafsnpssnvsatsftfqipnkkaqiscisskklhtqksfnfhdav
    tpmnkpsfgrdlmvaqateavaptteeaatsqpktskkakklkyprrildvyqilqspii
    teaaikniadensllftvdvradkkmireaisnffgvkvrkvntlirpdgtkkayimlnk
    eynaselakkigifpggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboV (V:)
    dvyqilqspiiteaaikniadensllftvdvradkkmireaisnffgvkvrkvntlirpd
    gtkkayimlnkeynaselakkigif
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3bboX (X:)
    mamatsmslnligafkglslsstssflrgdlsfspktsftvtlplenlqapipltiesah
    kkgagstkngrdspgqrlgvkiygdqvakpgaiivrqrgtkfhagknvgigkdhtifsli
    dglvkfekfgpdrkkisvypreivpenpnsyrarkrenfrlqrekkkarrenysytlptp
    elvlasasvddaeanpec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bboX (X:)
    ahkkgagstkngrdspgqrlgvkiygdqvakpgaiivrqrgtkfhagknvgigkdhtifs
    lidglvkfekfgpdrkkisvypreiv
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.