PDB entry 3bbn

View 3bbn on RCSB PDB site
Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
Class: ribosome
Keywords: small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex, ribosome
Deposited on 2007-11-09, released 2008-05-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: EM
Resolution: 9.4 Å
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s rRNA
    Species: Spinacea oleracea [TaxId:3562]
  • Chain 'B':
    Compound: ribosomal protein s2
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bbnb1
  • Chain 'C':
    Compound: ribosomal protein s3
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ribosomal protein s4
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ribosomal protein s5
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ribosomal protein s6
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: ribosomal protein s7
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bbng1
  • Chain 'H':
    Compound: ribosomal protein s8
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ribosomal protein s9
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ribosomal protein s10
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBN (Start-196)
    Domains in SCOPe 2.04: d3bbnj1
  • Chain 'K':
    Compound: ribosomal protein s11
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06506 (Start-139)
      • insertion (22-23)
    Domains in SCOPe 2.04: d3bbnk1
  • Chain 'L':
    Compound: ribosomal protein s12
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bbnl1
  • Chain 'M':
    Compound: ribosomal protein s13
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: ribosomal protein s14
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: ribosomal protein s15
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: ribosomal protein s16
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: ribosomal protein s17
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBN (Start-141)
    Domains in SCOPe 2.04: d3bbnq1
  • Chain 'R':
    Compound: ribosomal protein s18
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9M3K7
      • insertion (80-81)
    Domains in SCOPe 2.04: d3bbnr1
  • Chain 'S':
    Compound: ribosomal protein s19
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bbns1
  • Chain 'T':
    Compound: ribosomal protein s20
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBN
  • Chain 'U':
    Compound: Ribosomal Protein S21
    Species: Spinacea oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BBN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbnB (B:)
    ywninleemmeagvhfghgtrkwnprmspyisakckgihiinltrtarflseacdlvfda
    ssrgkqflivgtknkaadsvaraairarchyvnkkwlggmltnwsttetrlhkfrdlrme
    qtagrlarlpkrdaavvkrqlshlqtylggikymtglpdiviivdqqeeytalrecitlg
    ipticlidtncnpdladisipanddaiasirliltklvfaicegrssyirn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3bbnG (G:)
    msrrgtveektaksdpiyrnrlvnmlvnrilkhgkkslayqilyravkkiqqktetnpls
    vlrqairgvtpdiavkarrvggsthqvpieigstqgkalairwllgaarkrpgrnmafkl
    sselvdaakgsgdavrkkeethrmaeanrafahfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbnG (G:)
    srrgtveektaksdpiyrnrlvnmlvnrilkhgkkslayqilyravkkiqqktetnplsv
    lrqairgvtpdiavkarrvggsthqvpieigstqgkalairwllgaarkrpgrnmafkls
    selvdaakgsgdavrkkeethrmaeanrafahfr
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3bbnJ (J:)
    matsslstivfsplalsnsssfpnkpqvsnlslhsslsnlrrtlshsspssssssnvrvf
    aapevlesqetgpesyveegsetsalgigadsdqmapkqkiriklrsywvpliedsckqi
    mdaarttnaktmgpvplptkkrifcvlksphvhkdarfhfeirthqrlidilyptaqtid
    slmqldlpagvdvevkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbnJ (J:)
    qkiriklrsywvpliedsckqimdaarttnaktmgpvplptkkrifcvlksphvhkdarf
    hfeirthqrlidilyptaqtidslmqldlpagvdvevkl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3bbnK (K:)
    makpipkigsrrngrissrksasarkipkgvihvqasfnntivtvtdvrgrvvswasagt
    cgfrgtkrgtpfaaqtaagnairtvveqgmqraevmikgpglgrdaalrairrsgillsf
    vrdvtpmphngcrppkkrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbnK (K:)
    sarkipkgvihvqasfnntivtvtdvrgrvvswasagtcgfrgtkrgtpfaaqtaagnai
    rtvveqgmqraevmikgpglgrdaalrairrsgillsfvrdvtpmphngcrppkkrrv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbnL (L:)
    mptikqlirntrqpirnvtkspalrgcpqrrgtctrvytitpkkpnsalrkvarvrltsg
    feitayipgighnlqehsvvlvrggrvkdlpgvryhivrgtldavgvkdrqqgrskygvk
    kpk
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3bbnQ (Q:)
    fssirfqigrmitssltsslqalklsspfahgstplsslskpnsfpnhrmpalvpviram
    ktmqgrvvcatsdktvavevvrlaphpkykrrvrmkkkyqahdpdnqfkvgdvvrleksr
    pisktksfvalpviaraarkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbnQ (Q:)
    mktmqgrvvcatsdktvavevvrlaphpkykrrvrmkkkyqahdpdnqfkvgdvvrleks
    rpisktksfvalpviaraarkae
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3bbnR (R:)
    mdkskrpfikskrsfrrrlppiqsgdridyrnmslisrfiseqgkilsrrvnrltlkqqr
    litsaikqarilsllpflnnekekqfertesttrtanfrtknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bbnR (R:)
    gdridyrnmslisrfiseqgkilsrrvnrltlkqqrlitsaikqarilsllpflnnek
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbnS (S:)
    mtrslkknpfvanhllrkieklnkkaekeiivtwsrastiiptmightiaihngrehlpi
    yitdrmvghklgefaptlnfrghakndnksrr
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.