PDB entry 3bbf

View 3bbf on RCSB PDB site
Description: Crystal structure of the NM23-H2 transcription factor complex with GDP
Class: transferase
Keywords: transcription factor, cancer, kinase, nm23 gen, hexamer, Activator, Anti-oncogene, ATP-binding, Cell cycle, DNA-binding, Magnesium, Metal-binding, Nucleotide metabolism, Nucleotide-binding, Nucleus, Phosphorylation, Transcription regulation, Transferase
Deposited on 2007-11-09, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase B
    Species: Homo sapiens [TaxId:9606]
    Gene: NME2, NM23B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bbfa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase B
    Species: Homo sapiens [TaxId:9606]
    Gene: NME2, NM23B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bbfb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase B
    Species: Homo sapiens [TaxId:9606]
    Gene: NME2, NM23B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bbfc_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase B
    Species: Homo sapiens [TaxId:9606]
    Gene: NME2, NM23B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bbfd_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase B
    Species: Homo sapiens [TaxId:9606]
    Gene: NME2, NM23B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bbfe_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase B
    Species: Homo sapiens [TaxId:9606]
    Gene: NME2, NM23B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bbff_
  • Heterogens: GDP, MG, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbfA (A:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbfB (B:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbfC (C:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbfD (D:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbfE (E:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bbfF (F:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye