SCOPe 2.08: Structural Classification of Proteins

PDB entry 3bb1

View 3bb1 on RCSB PDB site
Description: Crystal structure of Toc34 from Pisum sativum in complex with Mg2+ and GMPPNP
Class: hydrolase
Keywords: Rossmann fold, GTPase domain, chloroplast import, GTP-binding, Hydrolase, Membrane, Nucleotide-binding, Outer membrane, Protein transport, Transmembrane, Transport
Deposited on 2007-11-09, released 2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1a_
Chain 'B':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1b_
Chain 'C':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1c_
Chain 'D':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1d_
Chain 'E':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1e_
Chain 'F':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1f_
Chain 'G':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1g_
Chain 'H':
Compound: Translocase of chloroplast 34
Species: Pisum sativum [TaxId:3888]
Gene: TOC34
Database cross-references and differences (RAF-indexed):
- Uniprot Q41009
  - engineered (9)
Domains in SCOPe 2.08: d3bb1h_
Heterogens: MG, GNP, PGE, GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3bb1A (A:)
masqqqtvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
evalnksesifvdknlidgpnpnqrglehhhhhh