PDB entry 3bas

View 3bas on RCSB PDB site
Description: Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (C2) form
Class: contractile protein
Keywords: Alpha-helical coiled coil, disorder, salt links, contractile protein, Actin-binding, ATP-binding, Calmodulin-binding, Cytoplasm, Motor protein, Muscle protein, Myosin, Nucleotide-binding, Thick filament
Deposited on 2007-11-08, released 2008-01-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin heavy chain, striated muscle/General control protein GCN4 chimera
    Species: Argopecten irradians, Saccharomyces cerevisiae [TaxId:31199,4932]
    Gene: -/GCN4, AAS3, ARG9, YEL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24733 (Start-54)
      • linker (55-56)
    • Uniprot P03069 (57-88)
    Domains in SCOPe 2.03: d3basa_
  • Chain 'B':
    Compound: Myosin heavy chain, striated muscle/General control protein GCN4 chimera
    Species: Argopecten irradians, Saccharomyces cerevisiae [TaxId:31199,4932]
    Gene: -/GCN4, AAS3, ARG9, YEL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24733 (4-54)
      • expression tag (1-3)
      • linker (55-56)
    • Uniprot P03069 (57-End)
    Domains in SCOPe 2.03: d3basb_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3basA (A:)
    gshmpllsiarqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkq
    ledkveellsknyhlenevarlkklvger
    

    Sequence, based on observed residues (ATOM records): (download)
    >3basA (A:)
    arqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveell
    sknyhlenevarlkklvger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3basB (B:)
    gshmpllsiarqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkq
    ledkveellsknyhlenevarlkklvger
    

    Sequence, based on observed residues (ATOM records): (download)
    >3basB (B:)
    shmpllsiarqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkql
    edkveellsknyhlenevarlkklvge