PDB entry 3ba2

View 3ba2 on RCSB PDB site
Description: Cyanide bound Chlorin substituted Myoglobin
Class: transport protein
Keywords: Myoglobin, Heme, Chlorin, Cyanide, CN, reconstituted, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport, TRANSPORT PROTEIN
Deposited on 2007-11-07, released 2008-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: EQUUS CABALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ba2a_
  • Heterogens: SO4, CYN, HKL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ba2A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ba2A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq