PDB entry 3ba0

View 3ba0 on RCSB PDB site
Description: Crystal structure of full-length human MMP-12
Class: hydrolase
Keywords: Full-length MMP-12, hemopexin domain, catalytic domain, domain interaction., Calcium, Extracellular matrix, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2007-11-07, released 2008-07-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.243
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-364)
      • engineered (65)
    Domains in SCOPe 2.06: d3ba0a1, d3ba0a2
  • Heterogens: ZN, CA, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ba0A (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslygdpkenqrlpnpdnsepalcdpn
    lsfdavttvgnkifffkdrffwlkvserpktsvnlisslwptlpsgieaayeiearnqvf
    lfkddkywlisnlrpepnypksihsfgfpnfvkkidaavfnprfyrtyffvdnqywryde
    rrqmmdpgypklitknfqgigpkidavfysknkyyyffqgsnqfeydfllqritktlksn
    swfgc