PDB entry 3b9u

View 3b9u on RCSB PDB site
Description: Crystal structure of L26N/D28N/H93G mutant of Human acidic fibroblast growth factor
Class: hormone
Keywords: beta-trefoil, Acetylation, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, HORMONE
Deposited on 2007-11-06, released 2008-04-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.191
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (31)
      • engineered (33)
      • engineered (98)
    Domains in SCOPe 2.04: d3b9ua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3b9uA (A:)
hhhhhhfnlppgnykkpkllycsngghflrinpngtvdgtrdrsdqhiqlqlsaesvgev
yikstetgqylamdtdgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkn
gsckrgprthygqkailflplpvssd

    Sequence, based on observed residues (ATOM records): (download) 
    >3b9uA (A:)
nykkpkllycsngghflrinpngtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
mdtdgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkngsckrgprthyg
qkailflplpvs