PDB entry 3b9s

View 3b9s on RCSB PDB site
Description: Macrophage Migration Inhibitory Factor (MIF) complexed with Inhibitor, 4-IPP.
Class: cytokine
Keywords: macrophage migration inhibitory factor, cytokine
Deposited on 2007-11-06, released 2008-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b9sa_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b9sb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b9sc_
  • Heterogens: GOL, RW1, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b9sA (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b9sB (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b9sC (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa