PDB entry 3b9j

View 3b9j on RCSB PDB site
Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
Class: oxidoreductase
Keywords: oxidoreductase, catalysis, intermediate, substrate orientation, peroxisome
Deposited on 2007-11-05, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9ja1, d3b9ja2
  • Chain 'B':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9jb1, d3b9jb2
  • Chain 'C':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9jc1, d3b9jc2
  • Chain 'I':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9ji1, d3b9ji2
  • Chain 'J':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9jj1, d3b9jj2
  • Chain 'K':
    Compound: xanthine oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9jk1, d3b9jk2
  • Heterogens: CA, FES, MTE, MOS, FAD, 290, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b9jA (A:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9jA (A:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b9jB (B:)
    kdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmii
    cpawipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfag
    kqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllg
    peeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggm
    adrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkf
    yltvlkklgkdskdkcgkldptytsatllfqkdppaniqlfqevpngqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9jB (B:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b9jC (C:)
    edtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvp
    gfvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvty
    edlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethct
    iaipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvs
    vavalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagn
    srdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmse
    vavtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnk
    encwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqv
    askalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknp
    dgswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltg
    dhknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstyki
    pafgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnn
    tkelfrldspatpekirnacvdkfttlcvtgapgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9jC (C:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnckpw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3b9jI (I:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9jI (I:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3b9jJ (J:)
    kdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmii
    cpawipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfag
    kqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllg
    peeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggm
    adrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkf
    yltvlkklgkdskdkcgkldptytsatllfqkdppaniqlfqevpngqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9jJ (J:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3b9jK (K:)
    edtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvp
    gfvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvty
    edlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethct
    iaipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvs
    vavalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagn
    srdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmse
    vavtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnk
    encwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqv
    askalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknp
    dgswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltg
    dhknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstyki
    pafgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnn
    tkelfrldspatpekirnacvdkfttlcvtgapgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9jK (K:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhttkel
    frldspatpekirnacvdkfttlcvtg