PDB entry 3b9i

View 3b9i on RCSB PDB site
Description: Crystal Structure of mouse GITRL at 2.5 A.
Class: cytokine
Keywords: GITRL; Glucocorticoid-Induced TNF Receptor Ligand, CYTOKINE, UNKNOWN FUNCTION
Deposited on 2007-11-05, released 2008-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf18, Gitrl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9ia_
  • Chain 'B':
    Compound: GITR ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Tnfsf18, Gitrl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b9ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b9iA (A:)
    gshmptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkk
    yikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntyw
    giilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9iA (A:)
    scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
    vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
    fis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b9iB (B:)
    gshmptaiescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkk
    yikdnapfvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntyw
    giilmpdlpfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b9iB (B:)
    scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
    vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
    fis