PDB entry 3b98

View 3b98 on RCSB PDB site
Description: Crystal structure of zebrafish prostacyclin synthase (cytochrome P450 8A1)
Class: isomerase
Keywords: prostacyclin synthase, cytochrome p450 8A1, CYP8A1, ISOMERASE
Deposited on 2007-11-03, released 2007-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.229
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin I2 synthase
    Species: Danio rerio [TaxId:7955]
    Gene: PGIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3b98a_
  • Chain 'B':
    Compound: Prostaglandin I2 synthase
    Species: Danio rerio [TaxId:7955]
    Gene: PGIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3b98b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b98A (A:)
    makktssvlygrrtrrrneppldkgmipwlghalefgkdaakfltrmkekhgdiftvraa
    glyitvlldsncydavlsdvasldqtsyaqvlmkrifnmilpshnpesekkraemhfqga
    sltqlsnsmqnnlrllmtpsemglktsewkkdglfnlcysllfktgyltvfgaennnsaa
    ltqiyeefrrfdkllpklarttvnkeekqiasaareklwkwltpsgldrkpreqswlgsy
    vkqlqdegidaemqrramllqlwvtqgnagpaafwvmgyllthpealravreeiqggkhl
    rleerqkntpvfdsvlwetlrltaaalitrdvtqdkkiclsngqeyhlrrgdrlcvfpfi
    spqmdpqihqqpemfqfdrflnadrtekkdffkngarvkypsvpwgtednlcpgrhfavh
    aikelvftiltrfdvelcdknatvplvdpsrygfgilqpagdleiryrirfhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b98A (A:)
    rtrrrneppldkgmipwlghalefgkdaakfltrmkekhgdiftvraaglyitvlldsnc
    ydavlsdvasldqtsyaqvlmkrifnmilpshnpesekkraemhfqgasltqlsnsmqnn
    lrllmtpsemglktsewkkdglfnlcysllfktgyltvfgaennnsaaltqiyeefrrfd
    kllpklarttvnkeekqiasaareklwkwltpsgldrkpreqswlgsyvkqlqdegidae
    mqrramllqlwvtqgnagpaafwvmgyllthpealravreeiqntpvfdsvlwetlrlta
    aalitrdvtqdkkiclsngqeyhlrrgdrlcvfpfispqmdpqihqqpemfqfdrflnad
    rtekkdffkngarvkypsvpwgtednlcpgrhfavhaikelvftiltrfdvelcdknatv
    plvdpsrygfgilqpagdleiryrir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b98B (B:)
    makktssvlygrrtrrrneppldkgmipwlghalefgkdaakfltrmkekhgdiftvraa
    glyitvlldsncydavlsdvasldqtsyaqvlmkrifnmilpshnpesekkraemhfqga
    sltqlsnsmqnnlrllmtpsemglktsewkkdglfnlcysllfktgyltvfgaennnsaa
    ltqiyeefrrfdkllpklarttvnkeekqiasaareklwkwltpsgldrkpreqswlgsy
    vkqlqdegidaemqrramllqlwvtqgnagpaafwvmgyllthpealravreeiqggkhl
    rleerqkntpvfdsvlwetlrltaaalitrdvtqdkkiclsngqeyhlrrgdrlcvfpfi
    spqmdpqihqqpemfqfdrflnadrtekkdffkngarvkypsvpwgtednlcpgrhfavh
    aikelvftiltrfdvelcdknatvplvdpsrygfgilqpagdleiryrirfhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b98B (B:)
    rtrrrneppldkgmipwlghalefgkdaakfltrmkekhgdiftvraaglyitvlldsnc
    ydavlsdvasldqtsyaqvlmkrifnmilpshnpesekkraemhfqgasltqlsnsmqnn
    lrllmtpsemglkwkkdglfnlcysllfktgyltvfgasaaltqiyeefrrfdkllpkla
    rttvnkeekqiasaareklwkwlswlgsyvkqlqdegidaemqrramllqlwvtqgnagp
    aafwvmgyllthpealravreeiqntpvfdsvlwetlrltaaalitrdvtqdkkiclsng
    qeyhlrrgdrlcvfpfispqmdpqihqqpemfqfdrflnadrtekkdffkngarvkypsv
    pwgtednlcpgrhfavhaikelvftiltrfdvelcdknatvplvdpsrygfgilqpagdl
    eiryrir