PDB entry 3b95

View 3b95 on RCSB PDB site
Description: EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 2)
Class: transferase/structural protein
Keywords: Ankyrin repeat, ANK repeat, Methyltransferase, Transferase, TRANSFERASE-STRUCTURAL PROTEIN COMPLEX
Deposited on 2007-11-02, released 2008-02-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.195
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Euchromatic histone-lysine N-methyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VT56 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d3b95a_
  • Chain 'B':
    Compound: Euchromatic histone-lysine N-methyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b95b_
  • Chain 'P':
    Compound: Histone H3 N-terminal Peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3B95 (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b95A (A:)
    hmnfkmehqnkrsplhaaaeaghvdichmlvqaganidtcsedqrtplmeaaennhleav
    kylikagalvdpkdaegstclhlaakkghyevvqyllsngqmdvncqddggwtpmiwate
    ykhvdlvklllskgsdinirdneeniclhwaafsgcvdiaeillaakcdlhavnihgdsp
    lhiaarenrydcvvlflsrdsdvtlknkegetplqcaslnsqvwsalqmskalqdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b95A (A:)
    hmnfkmehqnkrsplhaaaeaghvdichmlvqaganidtcsedqrtplmeaaennhleav
    kylikagalvdpkdaegstclhlaakkghyevvqyllsngqmdvncqddggwtpmiwate
    ykhvdlvklllskgsdinirdneeniclhwaafsgcvdiaeillaakcdlhavnihgdsp
    lhiaarenrydcvvlflsrdsdvtlknkegetplqcaslnsqvwsalqmskalqds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b95B (B:)
    hmnfkmehqnkrsplhaaaeaghvdichmlvqaganidtcsedqrtplmeaaennhleav
    kylikagalvdpkdaegstclhlaakkghyevvqyllsngqmdvncqddggwtpmiwate
    ykhvdlvklllskgsdinirdneeniclhwaafsgcvdiaeillaakcdlhavnihgdsp
    lhiaarenrydcvvlflsrdsdvtlknkegetplqcaslnsqvwsalqmskalqdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b95B (B:)
    rsplhaaaeaghvdichmlvqaganidtcsedqrtplmeaaennhleavkylikagalvd
    pkdaegstclhlaakkghyevvqyllsngqmdvncqddggwtpmiwateykhvdlvklll
    skgsdinirdneeniclhwaafsgcvdiaeillaakcdlhavnihgdsplhiaarenryd
    cvvlflsrdsdvtlknkegetplqcaslnsqvwsalqmskalqds
    

  • Chain 'P':
    No sequence available.