PDB entry 3b93

View 3b93 on RCSB PDB site
Description: crystal structure of human GITRL
Class: cytokine
Keywords: open trimer, asymmetric, C2 spacegroup, Cytokine, Glycoprotein, Membrane, Signal-anchor, Transmembrane
Deposited on 2007-11-02, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF18, AITRL, GITRL, TL6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b93a1
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF18, AITRL, GITRL, TL6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b93b_
  • Chain 'C':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF18, AITRL, GITRL, TL6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b93c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b93A (A:)
    gamasqletakepcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapn
    anyndvapfevrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknnty
    wgiillanpqfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b93A (A:)
    kepcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfe
    vrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpq
    fis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b93B (B:)
    gamasqletakepcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapn
    anyndvapfevrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknnty
    wgiillanpqfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b93B (B:)
    pcmakfgplpskwqmappcvnkvsdwkleilqnglyliygqvapvrlyknkdmiqtltki
    qnvggtyelhvgdtidlifnsehnntywgiillanpqfis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b93C (C:)
    gamasqletakepcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapn
    anyndvapfevrlyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknnty
    wgiillanpqfis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b93C (C:)
    pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapvrlyknkdmiqtl
    tskiqnvggtyelhvgdtidlitywgiillanpqfi