PDB entry 3b8k

View 3b8k on RCSB PDB site
Description: structure of the truncated human dihydrolipoyl acetyltransferase (e2)
Deposited on 2007-11-01, released 2008-01-22
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: 8.8 Å
R-factor: N/A
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoyllysine-residue acetyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: DLAT, DLTA
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3b8kA (A:)
gpgmapvptgvftdipisnirrviaqrlmqskqtiphyylsidvnmgevllvrkelnkil
egrskisvndfiikasalaclkvpeansswmdtvirqnhvvdvsvavstpaglitpivfn
ahikgvetiandvvslatkaregklqphefqggtftisnlgmfgiknfsaiinppqacil
aigasedklvpadnekgfdvasmmsvtlscdhrvvdgavgaqwlaefrkylekpitmll