PDB entry 3b8e

View 3b8e on RCSB PDB site
Description: Crystal structure of the sodium-potassium pump
Class: hydrolase/transport protein
Keywords: Na+, K+-ATPASE, P-TYPE ATPASE, CATION PUMP, MEMBRANE PROTEIN, HYDROLASE, ATP-BINDING, CALCIUM TRANSPORT, ION TRANSPORT, MEMBRANE POTENTIAL, PHOSPHORYLATION, Magnesium, Metal-binding, Nucleotide-binding, Potassium, Potassium transport, Sodium, Sodium transport, Sodium/potassium transport, Transmembrane, Glycoprotein, Signal-anchor, HYDROLASE/TRANSPORT PROTEIN COMPLEX
Deposited on 2007-11-01, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.277
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium/potassium-transporting ATPase subunit alpha-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b8ea1, d3b8ea2, d3b8ea3, d3b8ea4
  • Chain 'B':
    Compound: Sodium/potassium-transporting ATPase subunit beta-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b8eb_
  • Chain 'C':
    Compound: Sodium/potassium-transporting ATPase subunit alpha-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b8ec1, d3b8ec2, d3b8ec3, d3b8ec4
  • Chain 'D':
    Compound: Sodium/potassium-transporting ATPase subunit beta-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b8ed_
  • Chain 'G':
    Compound: Na+/K+ ATPase gamma subunit transcript variant a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b8eg_
  • Chain 'H':
    Compound: Na+/K+ ATPase gamma subunit transcript variant a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b8eh_
  • Heterogens: MG, RB, MF4, PC1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8eA (A:)
    akkerdmdelkkevsmddhklsldelhrkygtdlsrgltparaaeilardgpnaltpppt
    tpewvkfcrqlfggfsmllwigailcflaygiqaateeepqndnlylgvvlsavviitgc
    fsyyqeaksskimesfknmvpqqalvirngekmsinaeevvvgdlvevkggdripadlri
    isangckvdnssltgesepqtrspdftnenpletrniaffstncvegtargivvytgdrt
    vmgriatlasgleggqtpiaaeiehfihiitgvavflgvsffilslileytwleavifli
    giivanvpegllatvtvcltltakrmarknclvknleavetlgststicsdktgtltqnr
    mtvahmwsdnqiheadttenqsgvsfdktsatwlalsriaglcnravfqanqenlpilkr
    avagdasesallkcielccgsvkemrerytkiveipfnstnkyqlsihknpntaeprhll
    vmkgaperildrcssilihgkeqpldeelkdafqnaylelgglgervlgfchlflpdeqf
    pegfqfdtddvnfpldnlcfvglismidppraavpdavgkcrsagikvimvtgdhpitak
    aiakgvgiisegnetvediaarlnipvsqvnprdakacvvhgsdlkdmtseqlddilkyh
    teivfartspqqkliivegcqrqgaivavtgdgvndspaskkadigvamgiagsdvskqa
    admillddnfasivtgveegrlifdnlkksiaytltsnipeitpflifiianiplplgtv
    tilcidlgtdmvpaislayeqaesdimkrqprnpktdklvneqlismaygqigmiqalgg
    fftyfvilaengflpihllglrvnwddrwindvedsygqqwtyeqrkiveftchtpffvt
    ivvvqwadlvicktrrnsvfqqgmknkilifglfeetalaaflsycpgmgvalrmyplkp
    twwfcafpysllifvydevrkliirrrpggwveketyy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8eB (B:)
    tggswfkillfyvifygclagifigtiqvmlltisefkptyqdrva
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8eC (C:)
    akkerdmdelkkevsmddhklsldelhrkygtdlsrgltparaaeilardgpnaltpppt
    tpewvkfcrqlfggfsmllwigailcflaygiqaateeepqndnlylgvvlsavviitgc
    fsyyqeaksskimesfknmvpqqalvirngekmsinaeevvvgdlvevkggdripadlri
    isangckvdnssltgesepqtrspdftnenpletrniaffstncvegtargivvytgdrt
    vmgriatlasgleggqtpiaaeiehfihiitgvavflgvsffilslileytwleavifli
    giivanvpegllatvtvcltltakrmarknclvknleavetlgststicsdktgtltqnr
    mtvahmwsdnqiheadttenqsgvsfdktsatwlalsriaglcnravfqanqenlpilkr
    avagdasesallkcielccgsvkemrerytkiveipfnstnkyqlsihknpntaeprhll
    vmkgaperildrcssilihgkeqpldeelkdafqnaylelgglgervlgfchlflpdeqf
    pegfqfdtddvnfpldnlcfvglismidppraavpdavgkcrsagikvimvtgdhpitak
    aiakgvgiisegnetvediaarlnipvsqvnprdakacvvhgsdlkdmtseqlddilkyh
    teivfartspqqkliivegcqrqgaivavtgdgvndspaskkadigvamgiagsdvskqa
    admillddnfasivtgveegrlifdnlkksiaytltsnipeitpflifiianiplplgtv
    tilcidlgtdmvpaislayeqaesdimkrqprnpktdklvneqlismaygqigmiqalgg
    fftyfvilaengflpihllglrvnwddrwindvedsygqqwtyeqrkiveftchtpffvt
    ivvvqwadlvicktrrnsvfqqgmknkilifglfeetalaaflsycpgmgvalrmyplkp
    twwfcafpysllifvydevrkliirrrpggwveketyy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8eD (D:)
    tggswfkillfyvifygclagifigtiqvmlltisefkptyqdrva
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8eG (G:)
    yetvrngglifaalafivgliiilskrlr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b8eH (H:)
    yetvrngglifaalafivgliiilskrlr