PDB entry 3b87

View 3b87 on RCSB PDB site
Description: Complex of T57A Substituted Droposphila LUSH protein with Butanol
Class: transport protein
Keywords: Odorant binding protein, alcohol binding protein, Behavior, Olfaction, Pheromone response, Pheromone-binding, Secreted, Sensory transduction, Transport, TRANSPORT PROTEIN
Deposited on 2007-10-31, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General odorant-binding protein lush
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: lush, Obp76a, Obp76c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02372 (0-123)
      • engineered (56)
    Domains in SCOPe 2.08: d3b87a_
  • Chain 'B':
    Compound: General odorant-binding protein lush
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: lush, Obp76a, Obp76c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02372 (0-123)
      • engineered (56)
    Domains in SCOPe 2.08: d3b87b_
  • Heterogens: ACT, PE8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b87A (A:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagavnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b87B (B:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagavnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp