PDB entry 3b86
View 3b86 on RCSB PDB site
Description: Crystal structure of T57S substituted LUSH protein complexed with ethanol
Class: transport protein
Keywords: odorant binding protein, alcohol binding protein, Behavior, Olfaction, Pheromone response, Pheromone-binding, Secreted, Sensory transduction, Transport, TRANSPORT PROTEIN
Deposited on
2007-10-31, released
2008-02-05
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: General odorant-binding protein lush
Species: Drosophila melanogaster [TaxId:7227]
Gene: lush, Obp76a, Obp76c
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3b86a_ - Chain 'B':
Compound: General odorant-binding protein lush
Species: Drosophila melanogaster [TaxId:7227]
Gene: lush, Obp76a, Obp76c
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3b86b_ - Heterogens: ACT, PG4, EOH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3b86A (A:)
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagsvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3b86B (B:)
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagsvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp