PDB entry 3b7z

View 3b7z on RCSB PDB site
Description: Crystal Structure of Yeast Sec14 Homolog Sfh1 in Complex with Phosphatidylcholine or Phosphatidylinositol
Class: signaling protein
Keywords: Sec14, Golgi, phospholipid, phosphatidylinositol, phosphatidycholine, SIGNALING PROTEIN
Deposited on 2007-10-31, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein YKL091C
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b7za1, d3b7za2
  • Heterogens: B7N, 6PL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b7zA (A:)
    mghhhhhhhhmttsildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerld
    dstllrflrarkfdinasvemfveterwreeygantiiedyennkeaedkeriklakmyp
    qyyhhvdkdgrplyfeelgginlkkmykittekqmlrnlvkeyelfatyrvpacsrragy
    lietsctvldlkgislsnayhvlsyikdvadisqnyypermgkfyiihspfgfstmfkmv
    kpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhnpndkfyysdigpwrdp
    ryigpegeipnifgkftvts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b7zA (A:)
    sildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrarkf
    dinasvemfveterwreeygantiiedyennkeaedkeriklakmypqyyhhvdkdgrpl
    yfeelgginlkkmykittekqmlrnlvkeyelfatyrvpacsrragylietsctvldlkg
    islsnayhvlsyikdvadisqnyypermgkfyiihspfgfstmfkmvkpfldpvtvskif
    ilgssykkellkqipienlpvkyggtsvlhnpndkfyysdigpwrdpryigpegeipnif
    gkftvts