PDB entry 3b7y

View 3b7y on RCSB PDB site
Description: Crystal structure of the C2 Domain of the E3 Ubiquitin-Protein Ligase NEDD4
Class: ligase
Keywords: C2 DOMAIN, LIGASE, UBL-CONJUGATION PATHWAY, STRUCTURAL GENOMICS CONSORTIUM, SGC, Cytoplasm, Host-virus interaction, Phosphorylation, Polymorphism, Ubl conjugation pathway
Deposited on 2007-10-31, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase NEDD4
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD4, KIAA0093
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b7ya_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase NEDD4
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD4, KIAA0093
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b7yb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b7yA (A:)
    gmatcavevfglledeensrivrvrviagiglakkdilgasdpyvrvtlydpmngvltsv
    qtktikkslnpkwneeilfrvhpqqhrllfevfdenrltrddflgqvdvplyplptenpr
    lerpytfkdfvlhprshksrvkgylrlkmtylp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b7yA (A:)
    atcavevfglledeensrivrvrviagiglasdpyvrvtlydpmngvltsvqtktikksl
    npkwneeilfrvhpqqhrllfevfdenrltrddflgqvdvplyplptenprlerpytfkd
    fvlhprshksrvkgylrlkmtylp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b7yB (B:)
    gmatcavevfglledeensrivrvrviagiglakkdilgasdpyvrvtlydpmngvltsv
    qtktikkslnpkwneeilfrvhpqqhrllfevfdenrltrddflgqvdvplyplptenpr
    lerpytfkdfvlhprshksrvkgylrlkmtylp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b7yB (B:)
    atcavevfglledeensrivrvrviagiglakkdilgasdpyvrvtlydpmngvltsvqt
    ktikkslnpkwneeilfrvhpqqhrllfevfdenrltrddflgqvdvplyplptenpytf
    kdfvlhprshksrvkgylrlkmtylp