PDB entry 3b7h

View 3b7h on RCSB PDB site
Description: Crystal structure of the prophage Lp1 protein 11
Deposited on 2007-10-30, released 2007-12-04
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prophage Lp1 protein 11
    Species: Lactobacillus plantarum WCFS1 [TaxId:220668]
    Gene: lp_0634
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3b7hA (A:)
mktdgefvsehlmelitqqnltinrvatlaglnqstvnamfegrskrptittirkvcgtl
gisvhdffdfppynevek

    Sequence, based on observed residues (ATOM records):
    >3b7hA (A:)
mktdgefvsehlmelitqqnltinrvatlaglnqstvnamfegrskrptittirkvcgtl
gisvhdffdfppynev