PDB entry 3b7g

View 3b7g on RCSB PDB site
Description: Human DEAD-box RNA helicase DDX20, Conserved domain I (DEAD) in complex with AMPPNP (Adenosine-(Beta,gamma)-imidotriphosphate)
Class: hydrolase
Keywords: RNA, HELICASE, DEAD, CONSERVED DOMAIN I, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, ATP-binding, DNA-binding, Hydrolase, mRNA processing, mRNA splicing, Nucleotide-binding, Nucleus, Phosphorylation, Spliceosome
Deposited on 2007-10-30, released 2007-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX20
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX20, DP103, GEMIN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3b7ga_
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase DDX20
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX20, DP103, GEMIN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3b7gb_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b7gA (A:)
    smrtaqdlssprtrtgdvllaepadfeslllsrpvleglraagferpspvqlkaiplgrc
    gldlivqaksgtgktcvfstialdslvlenlstqililaptreiavqihsvitaigikme
    glechvfiggtplsqdktrlkkchiavgspgrikqlieldylnpgsirlfildeadklle
    egsfqeqinwiysslpaskqmlavsatypeflanaltkymrdptfvrlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b7gA (A:)
    adfeslllsrpvleglraagferpspvqlkaiplgrcgldlivqaksgtgktcvfstial
    dslvlenlstqililaptreiavqihsvitaigikmeglechvfiggtplsqdktrlkkc
    hiavgspgrikqlieldylnpgsirlfildeadklleegsfqeqinwiysslpaskqmla
    vsatypeflanaltkymrdptfvrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b7gB (B:)
    smrtaqdlssprtrtgdvllaepadfeslllsrpvleglraagferpspvqlkaiplgrc
    gldlivqaksgtgktcvfstialdslvlenlstqililaptreiavqihsvitaigikme
    glechvfiggtplsqdktrlkkchiavgspgrikqlieldylnpgsirlfildeadklle
    egsfqeqinwiysslpaskqmlavsatypeflanaltkymrdptfvrlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b7gB (B:)
    adfeslllsrpvleglraagferpspvqlkaiplgrcgldlivqaksgtgktcvfstial
    dslvlenlstqililaptreiavqihsvitaigikmeglechvfiggtplsqdktrlkkc
    hiavgspgrikqlieldylnpgsirlfildeadklleegsfqeqinwiysslpaskqmla
    vsatypeflanaltkymrdptfvrl