PDB entry 3b7a

View 3b7a on RCSB PDB site
Description: Complex of S52A Substituted Droposphila LUSH protein with Ethanol
Class: transport protein
Keywords: Odorant Binding Protein,Alochol Binding Protein, Behavior, Olfaction, Pheromone response, Pheromone-binding, Secreted, Sensory transduction, Transport, TRANSPORT PROTEIN
Deposited on 2007-10-30, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General odorant-binding protein lush
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: lush, Obp76a, Obp76c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02372 (0-123)
      • engineered (51)
    Domains in SCOPe 2.08: d3b7aa_
  • Chain 'B':
    Compound: General odorant-binding protein lush
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: lush, Obp76a, Obp76c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02372 (0-123)
      • engineered (51)
    Domains in SCOPe 2.08: d3b7ab_
  • Heterogens: ACT, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b7aA (A:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvalmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b7aB (B:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvalmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp