PDB entry 3b79

View 3b79 on RCSB PDB site
Description: Crystal structure of the N-terminal peptidase C39 like domain of the toxin secretion ATP-binding protein from Vibrio parahaemolyticus
Deposited on 2007-10-30, released 2007-11-13
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.158
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin secretion ATP-binding protein
    Species: Vibrio parahaemolyticus RIMD 2210633 [TaxId:223926]
    Gene: VPA1736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87FE3 (3-End)
      • expression tag (2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3b79A (A:)
snamkdpllnsliyvsryyglanspealvnglplsdgkltpfllpraaeraglvakenra
elekisslilpailvlkggdscvlnsinmetreaevttlesgmvpisipledlleqytgr
yflvkkqfr

    Sequence, based on observed residues (ATOM records):
    >3b79A (A:)
amkdpllnsliyvsryyglanspealvnglplsdgkltpfllpraaeraglvakenrael
ekisslilpailvlkggdscvlnsinmetreaevttlesgmvpisipledlleqytgryf
lvkkq