PDB entry 3b78

View 3b78 on RCSB PDB site
Description: Structure of the eEF2-ExoA(R551H)-NAD+ complex
Class: biosynthetic protein/transferase
Keywords: elongation factor, toxin, ADP-ribosylation, toxin-substrate complex, Cytoplasm, GTP-binding, Nucleotide-binding, Phosphoprotein, Protein biosynthesis, RNA-binding, rRNA-binding, Glycosyltransferase, NAD, Transferase, BIOSYNTHETIC PROTEIN/TRANSFERASE COMPLEX
Deposited on 2007-10-30, released 2008-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: eta
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (1-206)
      • expression tag (0)
      • see remark 999 (8)
      • see remark 999 (116)
      • engineered (152)
    Domains in SCOPe 2.01: d3b78b_
  • Chain 'C':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: eta
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (1-206)
      • expression tag (0)
      • see remark 999 (8)
      • see remark 999 (116)
      • engineered (152)
    Domains in SCOPe 2.01: d3b78d_
  • Chain 'E':
    Compound: Elongation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: exotoxin a
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: eta
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11439 (1-206)
      • expression tag (0)
      • see remark 999 (8)
      • see remark 999 (116)
      • engineered (152)
    Domains in SCOPe 2.01: d3b78f_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3b78B (B:)
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeegghletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3b78D (D:)
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeegghletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3b78F (F:)
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeegghletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg