PDB entry 3b6x

View 3b6x on RCSB PDB site
Description: Complex of S52A Substituted Drosophila LUSH protein with Butanol
Class: transport protein
Keywords: Odorant Binding, Alcohol Binding, Behavior, Olfaction, Pheromone response, Pheromone-binding, Secreted, Sensory transduction, Transport, TRANSPORT PROTEIN
Deposited on 2007-10-29, released 2008-02-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General odorant-binding protein lush
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: lush, Obp76a, Obp76c
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (1-124)
    • expression tag (0)
    • engineered (52)
  Domains in SCOPe 2.01: d3b6xa_
• Chain 'B':
  Compound: General odorant-binding protein lush
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: lush, Obp76a, Obp76c
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (1-124)
    • expression tag (0)
    • engineered (52)
  Domains in SCOPe 2.01: d3b6xb_
• Heterogens: ACT, 1BO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b6xA (A:)
  hmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvalmagtvn
  kkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadg
  qfmwp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b6xB (B:)
  hmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvalmagtvn
  kkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadg
  qfmwp