PDB entry 3b6x
View 3b6x on RCSB PDB site
Description: Complex of S52A Substituted Drosophila LUSH protein with Butanol
Class: transport protein
Keywords: Odorant Binding, Alcohol Binding, Behavior, Olfaction, Pheromone response, Pheromone-binding, Secreted, Sensory transduction, Transport, TRANSPORT PROTEIN
Deposited on
2007-10-29, released
2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-07-24, with a file datestamp of
2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: General odorant-binding protein lush
Species: Drosophila melanogaster [TaxId:7227]
Gene: lush, Obp76a, Obp76c
Database cross-references and differences (RAF-indexed):
- Uniprot O02372 (1-124)
- expression tag (0)
- engineered (52)
Domains in SCOPe 2.08: d3b6xa1, d3b6xa2 - Chain 'B':
Compound: General odorant-binding protein lush
Species: Drosophila melanogaster [TaxId:7227]
Gene: lush, Obp76a, Obp76c
Database cross-references and differences (RAF-indexed):
- Uniprot O02372 (1-124)
- expression tag (0)
- engineered (52)
Domains in SCOPe 2.08: d3b6xb1, d3b6xb2 - Heterogens: ACT, 1BO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3b6xA (A:)
hmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvalmagtvn
kkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadg
qfmwp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3b6xB (B:)
hmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvalmagtvn
kkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadg
qfmwp