PDB entry 3b6r

View 3b6r on RCSB PDB site
Description: Crystal structure of Human Brain-type Creatine Kinase
Class: transferase
Keywords: Brain type, Dimeric, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Phosphorylation, Polymorphism, Transferase
Deposited on 2007-10-29, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Creatine kinase B-type
    Species: Homo sapiens [TaxId:9606]
    Gene: CKB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b6ra1, d3b6ra2
  • Chain 'B':
    Compound: Creatine kinase B-type
    Species: Homo sapiens [TaxId:9606]
    Gene: CKB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b6rb1, d3b6rb2
  • Heterogens: ACT, MG, NO3, ADP, CRN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b6rA (A:)
    mpfsnshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtg
    vdnpghpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggdd
    ldpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmt
    eaeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvism
    qkggnmkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklp
    nlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvkll
    iemeqrleqgqaiddlmpaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6rA (A:)
    shnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdnpg
    hpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggddldpny
    vlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmteaeqq
    qliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvismqkggn
    mkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklpnlgkh
    ekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklliemeq
    rleqgqaiddlmpaqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b6rB (B:)
    mpfsnshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtg
    vdnpghpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggdd
    ldpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmt
    eaeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvism
    qkggnmkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklp
    nlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvkll
    iemeqrleqgqaiddlmpaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6rB (B:)
    shnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdnpg
    hpyimtvgcvagdeesyevfkdlfdpiiedrhggykpsdehktdlnpdnlqggddldpny
    vlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmteaeqq
    qliddhflfdkpvsplllasgmardwpdargiwhndnktflvwvneedhlrvismqkggn
    mkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklpnlgkh
    ekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklliemeq
    rleqgqaiddlmpaqk