PDB entry 3b6h

View 3b6h on RCSB PDB site
Description: Crystal structure of human prostacyclin synthase in complex with inhibitor minoxidil
Class: isomerase
Keywords: prostacyclin synthase, enzyme-inhibitor complex, cyp8a1, cytochrome p450, Endoplasmic reticulum, Fatty acid biosynthesis, Heme, Iron, Isomerase, Lipid synthesis, Membrane, Metal-binding, Polymorphism, Prostaglandin biosynthesis, Transmembrane
Deposited on 2007-10-29, released 2007-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostacyclin synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGIS, CYP8, CYP8A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16647 (Start-489)
      • expression tag (490)
    Domains in SCOPe 2.03: d3b6ha_
  • Chain 'B':
    Compound: Prostacyclin synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGIS, CYP8, CYP8A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16647 (Start-489)
      • expression tag (490)
    Domains in SCOPe 2.03: d3b6hb_
  • Heterogens: BOG, MXD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b6hA (A:)
    makktssllsrrrtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvg
    gryvtvlldphsydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllh
    relqalteamytnlhavllgdateagsgwhemglldfsysfllragyltlygiealprth
    esqaqdrvhsadvfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarra
    hrskwlesyllhleemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavr
    gelesilwqaeqpvsqtttlpqkvldstpvldsvlseslrltaapfitrevvvdlampma
    dgrefnlrrgdrlllfpflspqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlkny
    nmpwgaghnhclgrsyavnsikqfvflvlvhldlelinadveipefdlsrygfglmqpeh
    dvpvryrirphhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6hA (A:)
    rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
    ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
    nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
    vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
    leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqlpq
    kvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdrlllfpflspq
    rdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhclgrsyavnsik
    qfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b6hB (B:)
    makktssllsrrrtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvg
    gryvtvlldphsydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllh
    relqalteamytnlhavllgdateagsgwhemglldfsysfllragyltlygiealprth
    esqaqdrvhsadvfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarra
    hrskwlesyllhleemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavr
    gelesilwqaeqpvsqtttlpqkvldstpvldsvlseslrltaapfitrevvvdlampma
    dgrefnlrrgdrlllfpflspqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlkny
    nmpwgaghnhclgrsyavnsikqfvflvlvhldlelinadveipefdlsrygfglmqpeh
    dvpvryrirphhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6hB (B:)
    rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
    ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
    nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
    vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
    leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqtlp
    qkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdrlllfpflsp
    qrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhclgrsyavnsi
    kqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirph