PDB entry 3b6g

View 3b6g on RCSB PDB site
Description: Nucleosome core particle treated with oxaliplatin
Class: structural protein/DNA
Keywords: nucleosome, chromatin, platinum adduct, oxaliplatin, anti-cancer, drug, Acetylation, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, Phosphorylation, Ubl conjugation, STRUCTURAL PROTEIN/DNA COMPLEX
Deposited on 2007-10-29, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: 0.341
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
    Domains in SCOPe 2.07: d3b6ga1
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b6gb1
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: LOC494591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b6gc1
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • conflict (31)
    Domains in SCOPe 2.07: d3b6gd1
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
    Domains in SCOPe 2.07: d3b6ge1
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b6gf1
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: LOC494591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b6gg1
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • conflict (31)
    Domains in SCOPe 2.07: d3b6gh1
  • Chain 'I':
    Compound: 147-mer DNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: 147-mer DNA
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b6gA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gA (A:)
    ggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmal
    qeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b6gB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b6gC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gC (C:)
    ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b6gD (D:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gD (D:)
    dgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahyn
    krstitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3b6gE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gE (E:)
    atggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavm
    alqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3b6gF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gF (F:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3b6gG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gG (G:)
    kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkte
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3b6gH (H:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6gH (H:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.