PDB entry 3b6d

View 3b6d on RCSB PDB site
Description: Crystal Structure of Streptomyces Cholesterol Oxidase H447Q/E361Q mutant (1.2A)
Class: oxidoreductase
Keywords: FLAVOENZYME, FLAVIN, OXIDOREDUCTASE, FLAVIN ACTIVATION, CHOLESTEROL OXIDASE, Cholesterol metabolism, FAD, Flavoprotein, Lipid metabolism, Secreted, Steroid metabolism
Deposited on 2007-10-29, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.133
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholesterol oxidase
    Species: Streptomyces sp. [TaxId:74576]
    Gene: choA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12676
      • engineered (355)
      • engineered (441)
    Domains in SCOPe 2.07: d3b6da1, d3b6da2
  • Heterogens: SO4, FAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b6dA (A:)
    dnggyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrs
    swfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmave
    pkrsyfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkag
    lgtvfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiq
    tlhqvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtg
    tlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqiapm
    pagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkang
    tiyrydlfgtqlkafaddfcyqplggcvlgkatddygrvagyknlyvtdgslipgsvgvn
    pfvtitalaernveriikqdvtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b6dA (A:)
    gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
    knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
    syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
    vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
    qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
    nlnsevgagwgpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqiapmpag
    letwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiy
    rydlfgtqlkafaddfcyqplggcvlgkatddygrvagyknlyvtdgslipgsvgvnpfv
    titalaernveriikqdv