PDB entry 3b69

View 3b69 on RCSB PDB site
Description: T cruzi Trans-sialidase complex with benzoylated NANA derivative
Class: hydrolase
Keywords: beta-propeller, HYDROLASE
Deposited on 2007-10-28, released 2008-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-sialidase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26966 (14-End)
      • expression tag (12-13)
      • engineered (71)
      • see remark 999 (275)
      • see remark 999 (489)
      • see remark 999 (497)
      • engineered (508-509)
      • engineered (533)
      • see remark 999 (571)
      • engineered (606)
      • engineered (610)
      • engineered (612)
    Domains in SCOPe 2.08: d3b69a1, d3b69a2, d3b69a3
  • Heterogens: CL, BFN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b69A (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b69A (A:)
    aslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsf
    dnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrs
    ywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflgg
    agvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvaleweg
    kliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmr
    vmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclhei
    nsnevyslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsa
    tktewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvas
    vtihevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhv
    vltmankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvll
    ynrqlnaeeirtlflsqdligteahm