PDB entry 3b5n

View 3b5n on RCSB PDB site
Description: Structure of the yeast plasma membrane SNARE complex
Class: membrane protein
Keywords: SNARE complex, syntaxin, synaptobrevin, snap-25, Sso1p, Snc1p, Sec9p, Sec9, Sso1, Snc1, Coiled coil, Lipoprotein, Membrane, Palmitate, Transmembrane, Ubl conjugation, Phosphorylation, Protein transport, Transport, MEMBRANE PROTEIN
Deposited on 2007-10-26, released 2007-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: synaptobrevin homolog 1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SNC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31109 (1-60)
    • expression tag (0)
  Domains in SCOPe 2.03: d3b5na1
• Chain 'B':
  Compound: Protein SSO1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SSO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32867 (0-68)
  Domains in SCOPe 2.03: d3b5nb1
• Chain 'C':
  Compound: Protein transport protein SEC9
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SEC9, HSS7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40357 (2-68)
    • expression tag (0-1)
    • expression tag (69)
  Domains in SCOPe 2.03: d3b5nc1
• Chain 'D':
  Compound: Protein transport protein SEC9
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SEC9, HSS7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40357 (2-63)
    • expression tag (0-1)
• Chain 'E':
  Compound: synaptobrevin homolog 1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SNC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31109 (Start-60)
• Chain 'F':
  Compound: Protein SSO1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SSO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32867 (0-End)
  Domains in SCOPe 2.03: d3b5nf1
• Chain 'G':
  Compound: Protein transport protein SEC9
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SEC9, HSS7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40357 (2-68)
    • expression tag (0-1)
• Chain 'H':
  Compound: Protein transport protein SEC9
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SEC9, HSS7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40357 (2-63)
    • expression tag (1)
• Chain 'I':
  Compound: synaptobrevin homolog 1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SNC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31109 (Start-60)
• Chain 'J':
  Compound: Protein SSO1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SSO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32867
  Domains in SCOPe 2.03: d3b5nj1
• Chain 'K':
  Compound: Protein transport protein SEC9
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SEC9, HSS7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40357
• Chain 'L':
  Compound: Protein transport protein SEC9
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: SEC9, HSS7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40357 (2-End)
    • expression tag (1)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b5nA (A:)
  gsrtaelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkam
  w
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b5nB (B:)
  alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
  tdkavksar
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b5nC (C:)
  gsikftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvad
  ekvaelkklq
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >3b5nF (F:)
  alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
  tdkavksar
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3b5nF (F:)
  alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
  tdkavksa
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  Sequence, based on SEQRES records: (download)
  

  >3b5nJ (J:)
  alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
  tdkavksar
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3b5nJ (J:)
  aevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvghtd
  kavk
  

  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.