PDB entry 3b5l

View 3b5l on RCSB PDB site
Description: Crystal Structure of a Novel Engineered Retroaldolase: RA-61
Deposited on 2007-10-26, released 2008-01-22
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: endoxylanase
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B5L (0-197)
  • Heterogens: SO4, NH4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3b5lB (B:)
gshmdttitqnqtgydngyfysfwtdapgtvsmtlhsggsystswrntghfkagkgwstg
grrtvtynasfnpsgiayltlygwtrnplvsyliveswgtyrptgtykgtvttdggtydi
yetwrynapsiegtrtfqifwsvrqqkrtsgtitignhfdawaragmnlgshdyqimatk
gwqssgsstvsiseggnp