PDB entry 3b5g
View 3b5g on RCSB PDB site
Description: Crystal Structure of the Unstable and Highly Fibrillogenic PRO7SER Mutant of the Recombinant Variable Domain 6AJL2
Class: immune system
Keywords: Lambda VI subgroup, light chain variable domain, beta-sandwich, immunoglobulin, AL amyloidosis, IMMUNE SYSTEM
Deposited on
2007-10-25, released
2008-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3b5ga_ - Chain 'B':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3b5gb_ - Heterogens: ACT, GOL, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3b5gA (A:)
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3b5gB (B:)
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl