PDB entry 3b5g

View 3b5g on RCSB PDB site
Description: Crystal Structure of the Unstable and Highly Fibrillogenic PRO7SER Mutant of the Recombinant Variable Domain 6AJL2
Class: immune system
Keywords: Lambda VI subgroup, light chain variable domain, beta-sandwich, immunoglobulin, AL amyloidosis, IMMUNE SYSTEM
Deposited on 2007-10-25, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 3B5G (0-110)
    Domains in SCOPe 2.08: d3b5ga_
  • Chain 'B':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 3B5G (0-110)
    Domains in SCOPe 2.08: d3b5gb_
  • Heterogens: ACT, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b5gA (A:)
    nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b5gB (B:)
    nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl