PDB entry 3b45

View 3b45 on RCSB PDB site
Description: Crystal structure of GlpG at 1.9A resolution
Class: membrane protein
Keywords: intramembrane protease, integral membrane protein, serine protease, DNA-binding, Glycerol metabolism, Inner membrane, Transmembrane, MEMBRANE PROTEIN
Deposited on 2007-10-23, released 2008-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glpG
    Species: Escherichia coli [TaxId:562]
    Gene: glpG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b45a_
  • Heterogens: BNG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3b45A (A:)
eragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmh
ilfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgy
vwlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsl