PDB entry 3b44

View 3b44 on RCSB PDB site
Description: Crystal structure of GlpG W136A mutant
Class: membrane protein
Keywords: intramembrane protease, integral membrane protein, serine protease, DNA-binding, Glycerol metabolism, Inner membrane, Transmembrane, MEMBRANE PROTEIN
Deposited on 2007-10-23, released 2008-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glpG
  Species: Escherichia coli [TaxId:562]
  Gene: glpG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09391 (0-179)
    • engineered (45)
  Domains in SCOPe 2.08: d3b44a_
• Heterogens: BNG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b44A (A:)
  eragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefaryfthalmhfslmh
  ilfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgy
  vwlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsl