PDB entry 3b2w

View 3b2w on RCSB PDB site
Description: Crystal structure of pyrimidine amide 11 bound to Lck
Class: transferase
Keywords: Lck, Kinase domain, Alternative splicing, ATP-binding, Chromosomal rearrangement, Cytoplasm, Disease mutation, Host-virus interaction, Lipoprotein, Membrane, Myristate, Nucleotide-binding, Palmitate, Phosphorylation, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2007-10-19, released 2007-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3b2wa_
  • Heterogens: 9NH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b2wA (A:)
    tqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaf
    laeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldma
    aqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpik
    wtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdnc
    peelyqlmrlcwkerpedrptfdylrsvledfftate
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2wA (A:)
    wevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlqh
    qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee
    rnyihrdlraanilvsdtlsckiadfglarliedneytagakfpikwtapeainygtfti
    ksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwke
    rpedrptfdylrsvledffta