PDB entry 3b2u

View 3b2u on RCSB PDB site
Description: Crystal structure of isolated domain III of the extracellular region of the epidermal growth factor receptor in complex with the Fab fragment of IMC-11F8
Class: immune system/transferase
Keywords: CELL SURFACE RECEPTOR; GLYCOPROTEIN; ANTIGEN:ANTIBODY COMPLEX; FAB FRAGMENT; ANTITUMOR; DRUG, Anti-oncogene, ATP-binding, Cell cycle, Disease mutation, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase, IMMUNE SYSTEM-TRANSFERASE COMPLEX
Deposited on 2007-10-19, released 2008-02-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.03: d3b2ua1, d3b2ua2
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3b2ub1, d3b2ub2
  • Chain 'C':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-End)
    Domains in SCOPe 2.03: d3b2uc1, d3b2uc2
  • Chain 'D':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2ud1, d3b2ud2
  • Chain 'E':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3b2ue1, d3b2ue2
  • Chain 'F':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-End)
    Domains in SCOPe 2.03: d3b2uf1, d3b2uf2
  • Chain 'G':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2ug1, d3b2ug2
  • Chain 'H':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-End)
    Domains in SCOPe 2.03: d3b2uh1, d3b2uh2
  • Chain 'I':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.03: d3b2ui1, d3b2ui2
  • Chain 'J':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-End)
    Domains in SCOPe 2.03: d3b2uj1, d3b2uj2
  • Chain 'K':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2uk1, d3b2uk2
  • Chain 'L':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2ul1, d3b2ul2
  • Chain 'M':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.03: d3b2um1, d3b2um2
  • Chain 'N':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-222)
    Domains in SCOPe 2.03: d3b2un1, d3b2un2
  • Chain 'O':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2uo1, d3b2uo2
  • Chain 'P':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.03: d3b2up1, d3b2up2
  • Chain 'Q':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-End)
    Domains in SCOPe 2.03: d3b2uq1, d3b2uq2
  • Chain 'R':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2ur1, d3b2ur2
  • Chain 'S':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d3b2us1, d3b2us2
  • Chain 'T':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-End)
    Domains in SCOPe 2.03: d3b2ut1, d3b2ut2
  • Chain 'U':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2uu1, d3b2uu2
  • Chain 'V':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.03: d3b2uv1, d3b2uv2
  • Chain 'W':
    Compound: IMC-11F8 FAB Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-End)
    Domains in SCOPe 2.03: d3b2uw1, d3b2uw2
  • Chain 'X':
    Compound: IMC-11F8 FAB Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • PDB 3B2U (0-212)
    Domains in SCOPe 2.03: d3b2ux1, d3b2ux2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b2uA (A:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uA (A:)
    eekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqe
    ldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglr
    slkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcs
    pegcwgpeprdcvsc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b2uB (B:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uB (B:)
    ekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqel
    dilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrs
    lkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcsp
    egcwgpeprdcvsc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b2uC (C:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uC (C:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uD (D:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3b2uE (E:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uE (E:)
    ekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqel
    dilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrs
    lkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcsp
    egcwgpeprdcvsc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3b2uF (F:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uF (F:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uG (G:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3b2uH (H:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uH (H:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3b2uI (I:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uI (I:)
    kkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspe
    gcwgpeprdcvsc
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3b2uJ (J:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uJ (J:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uK (K:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uL (L:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3b2uM (M:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uM (M:)
    eekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqe
    ldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglr
    slkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcs
    pegcwgpeprdcvsc
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3b2uN (N:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uN (N:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uO (O:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3b2uP (P:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uP (P:)
    kkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspe
    gcwgpeprdcvsc
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3b2uQ (Q:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uQ (Q:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uR (R:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3b2uS (S:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uS (S:)
    ekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqel
    dilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrs
    lkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcsp
    egcwgpeprdcvsc
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3b2uT (T:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uT (T:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uU (U:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3b2uV (V:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uV (V:)
    kkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeld
    ilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrsl
    keisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspe
    gcwgpeprdcvsc
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3b2uW (W:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2uW (W:)
    qvqlqesgpglvkpsqtlsltctvsggsissgdyywswirqppgkglewigyiyysgstd
    ynpslksrvtmsvdtsknqfslkvnsvtaadtavyycarvsifgvgtfdywgqgtlvtvs
    sastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2uX (X:)
    eivmtqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyychqygstpltfgggtkaeikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrga