PDB entry 3b2t

View 3b2t on RCSB PDB site
Description: Structure of phosphotransferase
Class: transferase
Keywords: phosphotransferase, cell signaling, Alternative splicing, ATP-binding, Disease mutation, Ectodermal dysplasia, Glycoprotein, Heparin-binding, Immunoglobulin domain, Kinase, Lacrimo-auriculo-dento-digital syndrome, Membrane, Nucleotide-binding, Phosphorylation, Polymorphism, Receptor, Secreted, Transmembrane, Tyrosine-protein kinase, TRANSFERASE
Deposited on 2007-10-19, released 2008-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (Start-310)
      • engineered (170)
      • engineered (309)
    Domains in SCOPe 2.08: d3b2ta_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (0-End)
      • engineered (170)
    Domains in SCOPe 2.08: d3b2tb_
  • Heterogens: PO4, M33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b2tA (A:)
    pmlagvseyelpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavk
    mlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylr
    arrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvten
    nvmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweif
    tlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedl
    driltlttnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2tA (A:)
    seyelpedpkwefprdkltlgkplgegcfgqvvmaeavgidpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppqmtf
    kdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfglardinnidyykkt
    tngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkegh
    rmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlttnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b2tB (B:)
    pmlagvseyelpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavk
    mlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylr
    arrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvten
    nvmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweif
    tlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedl
    driltlttnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2tB (B:)
    pmlagvseyelpedpkwefprdkltlgkplfgqvvmaeavgidkpkeavtvavkmlkdda
    tekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppq
    mtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfglardinnidyy
    kkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllk
    eghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt