PDB entry 3b2r

View 3b2r on RCSB PDB site
Description: Crystal Structure of PDE5A1 catalytic domain in complex with Vardenafil
Class: hydrolase
Keywords: cGMP phosphodiesterase; PDE5-inhibitor potency; vardenafil; sildenafil; LevitraTM., Allosteric enzyme, Alternative splicing, cGMP-binding, Hydrolase, Magnesium, Metal-binding, Nucleotide-binding, Phosphorylation, Polymorphism, Zinc
Deposited on 2007-10-19, released 2008-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: HOMO SAPIENS
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (4-329)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d3b2ra2, d3b2ra3
  • Chain 'B':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: HOMO SAPIENS
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3b2rb_
  • Heterogens: VDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b2rA (A:)
    gshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqm
    khevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaa
    lshdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeyk
    ttlkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitk
    pwpiqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlye
    althvsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2rA (A:)
    gshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqm
    khevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaa
    lshdldhrgvchsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdla
    lyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvatef
    fdqgdkknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b2rB (B:)
    gshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqm
    khevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaa
    lshdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeyk
    ttlkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitk
    pwpiqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlye
    althvsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b2rB (B:)
    relqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlcr
    wilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdldh
    rgchsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlalyikrrge
    ffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateffdqkknki
    psmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq