PDB entry 3b2h

View 3b2h on RCSB PDB site
Description: Iodide derivative of human LFABP at high resolution
Class: lipid binding protein
Keywords: LFABP, Barium-SAD, Copper Kalpha, Palmitic acid, LIPID BINDING PROTEIN
Deposited on 2011-08-03, released 2012-06-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.217
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (4-129)
      • expression tag (2-3)
      • expression tag (130-131)
    Domains in SCOPe 2.03: d3b2ha_
  • Heterogens: PLM, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3b2hA (A:)
magssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagsk
viqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgd
ivfkriskrigt

    Sequence, based on observed residues (ATOM records): (download) 
    >3b2hA (A:)
gssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskvi
qneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdiv
fkriskrigt