PDB entry 3b1m

View 3b1m on RCSB PDB site
Description: Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative modulator Cerco-A
Class: transcription
Keywords: Transcription
Deposited on 2011-07-05, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.217
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b1ma_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: KRC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b1mA (A:)
    mrgshhhhhhgpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmns
    lmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndq
    vtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkf
    nalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfak
    llqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1mA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdly
    

  • Chain 'B':
    No sequence available.