PDB entry 3b1l

View 3b1l on RCSB PDB site
Description: Crystal Structure of parkin ubiquitin-like domain R33Q mutant
Class: ligase
Keywords: Parkin, Ubiquitin, proteasome, Alfa-Beta-protein, LIGASE
Deposited on 2011-07-04, released 2012-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: E3 ubiquitin-protein ligase parkin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVS6 (0-75)
      • engineered mutation (32)
    Domains in SCOPe 2.08: d3b1lx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b1lX (X:)
    mivfvrfnssygfpvevdsdtsilqlkevvakqqgvpadqlrvifagkelpnhltvqncd
    leqqsivhivqrprrr