PDB entry 3b1e

View 3b1e on RCSB PDB site
Description: Crystal structure of betaC-S lyase from Streptococcus anginosus in complex with L-serine: alpha-Aminoacrylate form
Class: lyase
Keywords: lyase
Deposited on 2011-06-29, released 2012-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b1ea_
  • Chain 'B':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b1eb_
  • Chain 'C':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b1ec_
  • Chain 'D':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3b1ed_
  • Heterogens: 0JO, EPE, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b1eA (A:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1eA (A:)
    skynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyt
    yasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvypp
    farsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerev
    leqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagt
    knsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqf
    aveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsege
    lharlniaapkslveeickrivcclpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b1eB (B:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1eB (B:)
    skynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyt
    yasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvypp
    farsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerev
    leqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagt
    knsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqf
    aveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsege
    lharlniaapkslveeickrivcclpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b1eC (C:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1eC (C:)
    ynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygytya
    sdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvyppfa
    rsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerevle
    qighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagtkn
    syaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqfav
    eyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsegelh
    arlniaapkslveeickrivcclpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b1eD (D:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1eD (D:)
    ynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygytya
    sdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvyppfa
    rsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerevle
    qighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagtkn
    syaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqfav
    eyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsegelh
    arlniaapkslveeickrivcclpk