PDB entry 3b1c

View 3b1c on RCSB PDB site
Description: Crystal structure of betaC-S lyase from Streptococcus anginosus: Internal aldimine form
Class: lyase
Keywords: lyase
Deposited on 2011-06-29, released 2012-06-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.149
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b1ca_
  • Chain 'B':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b1cb_
  • Chain 'C':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b1cc_
  • Chain 'D':
    Compound: BetaC-S lyase
    Species: Streptococcus anginosus [TaxId:1328]
    Gene: lcd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3b1cd_
  • Heterogens: PLP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3b1cA (A:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1cA (A:)
    skynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyt
    yasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvypp
    farsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerev
    leqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagt
    knsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqf
    aveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsege
    lharlniaapkslveeickrivcclpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3b1cB (B:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1cB (B:)
    kynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyty
    asdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvyppf
    arsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerevl
    eqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagtk
    nsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqfa
    veyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsegel
    harlniaapkslveeickrivcclpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3b1cC (C:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1cC (C:)
    skynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyt
    yasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvypp
    farsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerev
    leqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagt
    knsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqf
    aveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsege
    lharlniaapkslveeickrivcclpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3b1cD (D:)
    gplgsskynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeql
    vygytyasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlins
    pvyppfarsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrv
    werevleqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktf
    niagtknsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavle
    eniqfaveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdy
    gsegelharlniaapkslveeickrivcclpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3b1cD (D:)
    ynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygytya
    sdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvyppfa
    rsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerevle
    qighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagtkn
    syaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqfav
    eyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsegelh
    arlniaapkslveeickrivcclpk