PDB entry 3b0z

View 3b0z on RCSB PDB site
Description: crystal structure of cytoplasmic domain of flhb from salmonella typhimurium
Deposited on 2011-06-17, released 2012-06-20
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar biosynthetic protein flhB
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: flhB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Flagellar biosynthetic protein flhB
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: flhB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3b0zA (A:)
mklrmsrqdirdefkesegdphvkgkirqmqraaaqrrmmedvpkadvivtn

    Sequence, based on observed residues (ATOM records):
    >3b0zA (A:)
defkesegdphvkgkirqmqraaaqrrmmedvpkadvivtn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3b0zB (B:)
pthysvalqydenkmsapkvvakgaglialrireigaehrvptleapplaralyrhaeig
qqipgqlyaavaevlawvwqlkrwrlaggqrppqpenlpvpealdfmnekntda

    Sequence, based on observed residues (ATOM records):
    >3b0zB (B:)
pthysvalqydenkmsapkvvakgaglialrireigaehrvptleapplaralyrhaeig
qqipgqlyaavaevlawvwqlkrw